Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG028767t2
Common NameTCM_028767
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 597aa    MW: 66571.2 Da    PI: 6.7798
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG028767t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
                       7999************************************************9877 PP

             START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                        ++a++el k+a+a+ep+Wv+s+    e++n+de++++f+ +++      +s+ea+r++gvv+ +l++lv++++d++ qW+e+++    k++t
                       578999*********************************8888899*******************************.*************** PP

             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       ++vi++g      ga+qlm+aelq+l+plvp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+kvtwv
                       *************************************************************98.9**************************** PP

             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       eh +++++++h ++r +v+sgla+ga++w+atlq qce+
                       *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.2295155IPR001356Homeobox domain
SMARTSM003898.3E-1997159IPR001356Homeobox domain
PfamPF000467.5E-1998153IPR001356Homeobox domain
CDDcd000861.13E-16102153No hitNo description
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PROSITE profilePS5084839.795258494IPR002913START domain
SuperFamilySSF559617.28E-35260491No hitNo description
CDDcd088751.60E-115262490No hitNo description
Gene3DG3DSA:3.30.530.202.3E-7264484IPR023393START-like domain
SMARTSM002341.1E-75267491IPR002913START domain
PfamPF018529.4E-59268491IPR002913START domain
SuperFamilySSF559611.37E-6513596No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5309130.0AF530913.1 Gossypium hirsutum homeodomain protein GhHOX1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024189.10.0HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A061GB600.0A0A061GB60_THECC; HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1
STRINGPOPTR_0003s05100.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53